SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101909|ref|YP_003553767.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101909|ref|YP_003553767.1|
Domain Number 1 Region: 19-140
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 0.000000000392
Family Serine dehydratase beta chain-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|294101909|ref|YP_003553767.1|
Domain Number - Region: 343-475
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.000889
Family 2-methylcitrate dehydratase PrpD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101909|ref|YP_003553767.1|
Sequence length 516
Comment L-serine dehydratase, iron-sulfur-dependent subunit alpha [Aminobacterium colombiense DSM 12261]
Sequence
MKHSILNDVLGPVMRGPSSSHTAASYRIAAIARSLLKSSLKEVIFTFDREGSYGEVFRQQ
GSDLAFAAGALGWDITDSRFEDVLGIAQRKGKLILFQIDDISDSNHPNEVLVSMAGTGGD
SVELLARSVGGGAIVITKIDGWPVWITGDSHDLFIVTNSEGKDSLLLKIEEHNRNERSVT
IHERDGQFLIHIAYLRRPVKEILKNLESMTGVLSLKISCPVVYACPGEPLFTSAKELLKI
VGEKGKSLADASLSYESQMLKLPEEEIWAEMSSRLEIMEEAARAGIEDHPFEMKLIRPSA
GKIYKAEIEGKLPIGGLHSQAMARALGVMHVNASKGIICAAPTAGSSGVIPGVILTLAER
FRLSREEKIRALFTASAIGLIVAIRATFSAEVAGCQAEIGVAGAMASAAVVEVAGGSPEQ
ALDAASIFLQNSLGSICDPVQGFVEIPCHTRNGVAASSAFVCADIVMGGYFNPLPFDEVV
DAMYSVGKLLPRELRCTAKGGLSICPSGCALPLLSK
Download sequence
Identical sequences D5EER1
gi|294101909|ref|YP_003553767.1| WP_013048306.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]