SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294102401|ref|YP_003554259.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102401|ref|YP_003554259.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 9.03e-24
Family Ribosomal protein L9 C-domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 9.59e-18
Family Ribosomal protein L9 N-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102401|ref|YP_003554259.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Aminobacterium colombiense DSM 12261]
Sequence
MKVILKEDVAKLGSKGDLIETSDGYARNYLFPRGLAEEATPAKLKEWKKVKEARERKEEK
MLAEAQAKSRKLQGKRVIVKASAGESGKLFGSVTNGHIEEALKNQLDVSIDKKDIRLDEN
IRNTGNYSFTVKLYQGVEARMTVKVEAE
Download sequence
Identical sequences D5EG53
gi|294102401|ref|YP_003554259.1| WP_013048798.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]