SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102499|ref|YP_003554357.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102499|ref|YP_003554357.1|
Domain Number 1 Region: 167-253
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-35
Family CodY HTH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 30-174
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000638
Family GAF domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102499|ref|YP_003554357.1|
Sequence length 261
Comment GTP-sensing pleiotropic transcriptional repressor CodY [Aminobacterium colombiense DSM 12261]
Sequence
MKDLLDKTRQVGRALQSRREGTKPDYSKLAKLLCEFSTANVYIINREGRILVHSWVSEYH
SEAVANFLERGYMPESFVEKMNQHRESILSETDGYLFDDEVASKEAPEKHLLYVPIYSAA
ERLGTLLLVRFFNPFYMKDLILAEYLATLVGIEILHDRTRSIEERARERLVVQMAMRALS
YSEVESVKHIIAELGTYEGVVIASKVADRVGVTRSVIVNALRKLESAGIIESRSLGMKGT
FIKILSPLFIEELGMVLTQNN
Download sequence
Identical sequences D5EGF1
WP_013048896.1.58668 gi|294102499|ref|YP_003554357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]