SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261823393|ref|YP_003261499.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261823393|ref|YP_003261499.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.72e-39
Family Frataxin-like 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261823393|ref|YP_003261499.1|
Sequence length 106
Comment frataxin-like protein [Pectobacterium wasabiae WPP163]
Sequence
MNDSEFHQLADKLMLQLEETLDRFEGDADIDYEINGGVMTLSFENGSKIVINRQEPLHQI
WLATKAGGYHFALQAERWVCNRSGEDFLVLLSSACSAQAGETVHFE
Download sequence
Identical sequences A0A0H3IA97 D0KC04
WP_014701770.1.14155 WP_014701770.1.36680 WP_014701770.1.70306 WP_014701770.1.77019 WP_014701770.1.78307 gi|470156751|ref|YP_006285253.1| 561231.Pecwa_4168 gi|261823393|ref|YP_003261499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]