SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000071 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000071
Domain Number 1 Region: 152-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.9e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 77-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.39e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 2-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.43e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000071   Gene: ENSAPLG00000000667   Transcript: ENSAPLT00000000639
Sequence length 242
Comment pep:novel scaffold:BGI_duck_1.0:KB743446.1:373574:374299:-1 gene:ENSAPLG00000000667 transcript:ENSAPLT00000000639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY
NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL
IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVK
AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
TI
Download sequence
Identical sequences U3HYK1
ENSAPLP00000000071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]