SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000293 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000293
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-42
Family Forkhead DNA-binding domain 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000293   Gene: ENSAPLG00000000883   Transcript: ENSAPLT00000000861
Sequence length 118
Comment pep:novel scaffold:BGI_duck_1.0:KB742851.1:329436:329789:1 gene:ENSAPLG00000000883 transcript:ENSAPLT00000000861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPPQKPPYSYIALIAMAIKEAPEQKVTLSGIYQFIMDRFPFYHDNKQGWQNSIRHNLSL
NDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKAAGPPEARSGAVPPD
Download sequence
Identical sequences R0LP48
ENSAPLP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]