SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000377 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000377
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-29
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 334-390
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000103
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000377   Gene: ENSAPLG00000000958   Transcript: ENSAPLT00000000945
Sequence length 404
Comment pep:novel scaffold:BGI_duck_1.0:KB743005.1:2533621:2538015:1 gene:ENSAPLG00000000958 transcript:ENSAPLT00000000945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRYHKAAADGNLDLLKEATRKDLNTSDEDGMTPTLLAAYHGYLEALEVICRRGGDPDK
CDIWGSTPLHHAACNGHIHCVSFLINFGANIFALDNDLRTPLEVAASRDRHECVRILDKA
ATEQNLLNPKKVAKQKAQAQRNVEKQIKECEKRQEKHQHEMNRNYMKENAGTVTSSKGTH
SRVKIPSLFTSNTTTPFSKNLKDTFKLRTKKTAGSTRSQETQSNGQADEKDRRSVMHLFD
EKEEDELLNDNDSRLSIFQRPGLGKIVFGRNLAADVNPGIMSPEKEVISFKMSSELFQNE
SAENDREDDVENGADIPWQEEEGIWDDEEAENTPLEVFLASQMLDEFLPVFMREKIDLDT
LMLCSDEDLQSIQIELGPRKKVLNAVNKRKQALKNPGKTVDTCL
Download sequence
Identical sequences R0JXK4
XP_005018573.1.99704 ENSAPLP00000000377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]