SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000531 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000531
Domain Number 1 Region: 294-349,378-582
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.75e-39
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 10-122
Classification Level Classification E-value
Superfamily ARID-like 1.44e-30
Family ARID domain 0.00066
Further Details:      
 
Domain Number 3 Region: 232-294
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-17
Family PHD domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1084-1167
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000266
Family PHD domain 0.0096
Further Details:      
 
Domain Number 5 Region: 1547-1607
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000031
Family PHD domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000531   Gene: ENSAPLG00000000585   Transcript: ENSAPLT00000001099
Sequence length 1637
Comment pep:novel scaffold:BGI_duck_1.0:KB742547.1:281779:325424:-1 gene:ENSAPLG00000000585 transcript:ENSAPLT00000001099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWQPPFACEVQSFRFTPRIQRLNELEAMTRVKLDFLDQLAKFWELQGSNLKIPVVERKIL
DLYGLSKIVASKGGFEVVTKEKKWSKVASRLGYLPGKGTGSLLKSHYERILYPYELFQSG
VSLMGIQKPNLDLKEKVEAEDLSSDAQASPKQGSRMNVVLKRTRRVKSQAETGEMSRNTE
LKKLQIFGAGPKMMGLALGAKDKEDEVTRRRKGTRSEAFGMQMRQRKGTLSVNFVDLYVC
LFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQ
AVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSK
DFGSGFPVKDGRRKLMPEEEDYALSGWNLNNMPILEQSVLAHINADISGMKVPWLYVGMC
FSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMKELAPELFESQPDLLHQL
VTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGR
QCVSHYRRLGRHCVFSHEELIFKMAADPECLDVGLAAMVCKEMTLMIEEETRLRESVVQM
GVLMSEEEVFELVPDDERQCTACRTTCFLSALTCSCNPERLVCLYHPSDLCPCPMQKKCL
RYRYPLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANLNHKKDVIELRVMLEDAEDRKYP
ENDLFRKLRDAVKEAETCASVAQLLLSKKQKHSRQSQDSGRTRTKLTMEELKAFVQQLFS
LPCVISQARQVKNLLDDVEEFHERAQEAMMDEIPDSSKLQELIDMGSGLYVELPELPRLK
QELQQARWLDEVRSTLLDPQRVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERW
EEKAKVCLQARPRQSMMALEGIVNEAKNIPAYLPNVLALKEALQRARDWTAKVEAIQNGS
NYAYLEQLENLSAKGRPIPVRLDALPQLESQVAAARAWRERTGRTFLKKNSSYSLLQVLS
PRTDIGVYGSSKNRRKRAKELMEKEKEKDLDLESLSELEDGLEEARDTAAVVAVFKEREQ
KEIEAMHALRAANLAKMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHSGCVPLPKTS
SQKKGSSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMS
WQDRARQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLTS
FQQSAFNRVIGSVSSSPRQTLDYDDEETDSDEDIRETYGYDIKDNASVKSSSSLEPNLFC
DEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVL
ELSPGAKAQLEDLMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHVMEDDSMDEKPLK
MRGRDSSERKRKRKLERAEQFFGDMKQKSKELKKLEKPKKKKLKLTMDKTKELNKLAKKL
AKEEERKKKREKAVVAKVELTKDSTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNC
QRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKPMQGPSSPAHAPPP
PFLLSYKLPLEDLKETS
Download sequence
Identical sequences R0KAA7
ENSAPLP00000000531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]