SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000573 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000573
Domain Number 1 Region: 102-478
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000265
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.59e-23
Family Ubiquitin-related 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000573   Gene: ENSAPLG00000000901   Transcript: ENSAPLT00000001141
Sequence length 492
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742418.1:1973291:1989164:-1 gene:ENSAPLG00000000901 transcript:ENSAPLT00000001141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLFAVNVKWGKEKFDGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
LKIKNGMTLLMMGSADALPEEPIARPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPEVKEALKRYGGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQMMRVLQQKLEGIEGDTVMETDSGAAATTSKKKSL
IDQFFSIEFETAMKCTEAEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKLS
PTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPD
LQEKMVSYRSKFKDLEDKKVNQQPKNSSKSDGAQKEVKYEPFSFPDDIGSNNCGYYDLQA
VLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGP
RRIEVIEDEAEQ
Download sequence
Identical sequences U3I003
ENSAPLP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]