SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000598 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000598
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000344
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000000598
Domain Number - Region: 1043-1110
Classification Level Classification E-value
Superfamily TPR-like 0.000818
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000598   Gene: ENSAPLG00000001183   Transcript: ENSAPLT00000001167
Sequence length 1546
Comment pep:novel scaffold:BGI_duck_1.0:KB742588.1:1052233:1056870:-1 gene:ENSAPLG00000001183 transcript:ENSAPLT00000001167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLDYNTLPVDKWDENHVQCWLQSTGIKEEYTRKLHEEEVTGPVLMELNEPFLKKIGMKKG
QIHILLLKRDELQQQQENTKQEKHFSSKMPARIDTQRDSVRPKDVGPQKSLGKDSCGPPH
ETSGENTASARSKKQGRNKSQPQNTDEVLDISKYRPFRSEDTDFKYVKGQVLSPETGVNG
LIIPCHEYKSFAIAAELNRQQLQSKFAYEVIRFASACMNIRTNGTIHFGIMDSVEDKGYK
HGQIIGIKVKDREHYVDALDYIEKCFPETKQETARKCIHPPVFIEVISKDSQEQRFVVEV
DIEPTSSLVKNQTFDVYLPKYNESSQKVTLTKERALYQRLGAKSELVKPDDLIAFIEGSK
DRDAQREKAELLSTEVHTEVSQNLGRKLSILLNDGKNYMDDSLRYILVTNRCTEDDLNSI
NFLMHLNVFCVFDFDEHSVSGLYGKYKEHHATRSYFLQDFSNESKTGNPPSQKHLCLFDQ
TSWIFCNGRSDYRGDEGKPCDENTWIRTKKKYLKKAITRICDEILPKRSFIVLFLLLSPV
KKPIVDTFQEFYTEMNGMEYIICIAESRENYVKWANLAQTSCSIETLEQRSIVGMKLSHV
DATIQKMLPSTAHPRHLPVSTRALCMLPSLEEEKMFSLEILCVDQCDDTKLDLLSEKEIQ
EIEQNFYKGRKITWKNFWLADKGHCGEIIEREACKDASKLLDDILQGTGLNYSVAKLKIF
HHPGSGGSTIARQVLWKRRKDLRCAVIKSSYSPATVCEHALAFRDYEEKEINHCLPVLLL
IEDYDEDYLEEIRNDLMDAVATRKINSPRPYFILMSCRRSNDPERLCKASPLDTVAVTHK
LTDSEKTLFKTKLEKLKQKYVEPKFILTFVLMCEEFNETYVRDFVGHILQDIDHSSRDTR
LMHYVALLNFYVPNSYVSLSHCEAFLGLGAYTETKSRAYDFKSNLSEQARMIFIELREST
TYISSVRIIHCLVAKEILYQLSRNQPQSQIAMSLLQERMLFENRFGREEFIKFIRDLFIR
RDKRSRGDNTDSLFSPFIEHVCKAEDCEKAIAVLKAAYELLGKDAFFAQQLARLHYNNEK
FEDAKYWVGVAKLHLPNDSYILDTEGQVYRKWFSFTVDKVTDIPDIDKIEIALKAMKCFR
AAQQAAKAETDNMNNAGYFGEVEVGCRLLKFLSTLDVFRASPEGEHSELVKYLITDYIPK
DIEKTWGKLHSRLRGLRQNLYNALEWISEDLSYFQTDKNHEKEDDDGKAEKEEQVYNPRK
WLKRQSEVYAKFFISASLTGDNSGPKSQLMKGMTIYKRGGGSVTNILSFLTDKKENRSAE
KLEEILSFYPENALRDRLEDTDLINYILSHIVLACLSPGSAKLLPMQTLRELSTRFCKGK
RMLPASAYFLLTLLFWPDEALDKEPNSAKDEILSSALQTLKRLYDIKMKDVPPRKKRIYT
HFFLGKGYGLSKIVQKNKIDKLISGSLDEKRMKWLHGTVWNNTMIGHILRRVSGWTKDRN
LFIRGHIKEFPVLALHRDSVPNGNENVTFYLGFSFNGLVAFNIEVE
Download sequence
Identical sequences U3I028
ENSAPLP00000000598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]