SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000610 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000610
Domain Number 1 Region: 520-585,626-723
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-30
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 2 Region: 1143-1275
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-19
Family Second domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 732-850
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 1044-1149
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000158
Family Ubiquitin-related 0.05
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000000610
Domain Number - Region: 35-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0637
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000610   Gene: ENSAPLG00000001036   Transcript: ENSAPLT00000001179
Sequence length 1419
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743356.1:91616:131275:-1 gene:ENSAPLG00000001036 transcript:ENSAPLT00000001179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELAVENGSCTDWQKRCIALESQLFKFRLQASKIRELLAEKMQELEQRVMEAEQRAEDA
EKQVRIMEEEIKLANMKTGESDSALYRKYQELMGTVQGKEDLINRLETQLAKQKQLRTEE
LKIVQEKAAKIKEWVTFKLRELELENYHLKNCNQRLTEQIEALQDTLQGITLFGCHKSSS
LISHLGLNMGPCFETGTAHGELWSSGLEPSALGNEQFHPVLLSHFSHYARLNPEAPAEGQ
IFLLATLTIRASSASCHIHCNSLKSRAPQASLPEKIDQKSMFLAPGFRQLCQTRPTKRVF
STTSIVLANDTFTEDGEVPTTWIPLPQTAGPPLAMSTSAATAGSICPGRECGLGSSMTFP
KTRTPNAPRDSIQLAKRHYSQPQSGAGSFHRVMSLEASTFQPIPVCHGPVEETDIDDYRV
LEKMETEGGLVREEAGTYEIKHLTAKREAVSSEAGMLDPGCKPPTPPLHRFPSWESRIYD
MAKSGMRLSEAAAVNDASSCFSNFSRSASGPFTGFIHRNMAVPVYAMLKGKATQISNVPF
LDESSGSDDDCGSHASFRNSTAGSENRKASMPGSPRAVKRGVSMSSLSSESDYAIPPDAY
SLDGDYSEPEHKLQRTSSYSTDGGICTESMEKSGYLLKMGSQVKMWKRRWFVLRNGQIMY
YKSPSDVIRKPQGQMELNSSCQIVRGEGSQTFQLMTEKRTYFLTADSPNILEEWIHVLQS
ILRVQVTSPVGVPHSDAKPTVKGWLTKVKHGHSKLVWCALIGKNFYYYRNHEDKCPLGHL
PLRESKVEEVDRSCDSDEDYEATGGGLLSSHCTLVIHPQDQSPTYLLIRTKHEKNTWLYH
LTVAAGSSNATVGTSYEQLIGKLLDAEGDPNSPLWKHPMLCYSKDGLHTSLTTLPSEALQ
TEALKLFKSCQLFINVPVEAPSVDYHVSLAQTALQVCLTHTELQNEIYCQLVKQTSCRQP
QNHSVIQCWQLLALCAPLFLPQHHFLWYIKQHFQRHADPRSEIGKYAIYCQRSVDRTVQT
GEREAKPSRMEIVSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDGSSTVDEFIQRLNQET
GMRKPSHMGFSLFTDDPSGRDLEHCLQGNIKICDVISKWEQALKELHPGKYEGGTRIVKL
TYKNRLYFRSQAKGETDRERLLLAFQVSNEIASGRFPVNKELALEMVALMAQVEYGDLDR
PGSSSPGGTSQPKMQHLLHQVLDKFYPKRYKQNIAPEQLKQLADRLATKWMVLQGCSPPE
CVRIYLTVARKWPLFGTKMFAAKPILPSSLEDCPVWIAVNEDGISILDYNTMHLKLSYSY
SSVLTFGGCRDDFMIVVSQIKERSSGKNSTEKLLFAMAIPKIVEATLLIASYINYRSTAS
LLPSTQPSRNATPANKLWETESRCFFPSKPRSTKGPTLL
Download sequence
Identical sequences U3I040
ENSAPLP00000000610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]