SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000615 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000615
Domain Number 1 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.48e-16
Family Heat-shock transcription factor 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000615   Gene: ENSAPLG00000001200   Transcript: ENSAPLT00000001184
Sequence length 110
Comment pep:novel scaffold:BGI_duck_1.0:KB742931.1:3555478:3555807:-1 gene:ENSAPLG00000001200 transcript:ENSAPLT00000001184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSSEERAVKTNVFSFLSFPTKLWYLVESDEFKSICWARCESCIVIDEEMFNVEVLGRTG
PQKIFEADSVKSFIRELNLYGFTKMKWTFPRSASLPKFMAEDAFSAHRKV
Download sequence
Identical sequences U3I045
ENSAPLP00000000615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]