SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000638 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000638
Domain Number 1 Region: 215-381,681-899,954-999
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-113
Family Ras GEF 0.0001
Further Details:      
 
Domain Number 2 Region: 362-448
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-18
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 93-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000221
Family cAMP-binding domain 0.00083
Further Details:      
 
Domain Number 4 Region: 591-670
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000672
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000638   Gene: ENSAPLG00000000967   Transcript: ENSAPLT00000001208
Sequence length 1474
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742853.1:1527218:1571007:1 gene:ENSAPLG00000000967 transcript:ENSAPLT00000001208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPE
TAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSFG
VSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHREL
DRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWF
NDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAK
AKRRLITLTKPSREAPLPFILLGGSEKGFGIFVDSVDFGSKATEAGLKRGDQILEVNGQN
FENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRY
SIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYKCSDIGIGQS
QDDSIVGLRQTKHIPPALPVSGTLSSSNPDLLQSHHRILDFNTTPDLPDQVLRVFKADQQ
SRYIMISKDTTAKEVVIQAIREFALTATPDAYSLCEVSVTPEGVIKQRRLPDQLSKLADR
IQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEP
TEYIDDLFKLKSKTGCTNLKKFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHC
RECKNFNSMFAIISGLNLAPVARLRTTWEKLPSKYEKLFQDLQDLFDPSRNMAKYRNVLN
SQNLQPPIIPLFPVIKKDLTFLHEGNDSKVEGLVNFEKLRMIAKEIRHVGRMASVNMDPA
LMFRTRKKKWRSLGSLSQGSTNAAVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVK
QYLSNLDLEMDEESLQTLSLQCEPATNTLPKNTGDKRSGKSETSPVAPRAGIQQKVQQQQ
QHKVNQALQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLDRHKKQSEDT
ISSASSQLSSPPTSPQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSMPVS
LHDERRQRHSVSIVETNLGVGRIDRRIMIEPDQYSLGSFAPLPENRGLYAGATVLSSPST
EELSQDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHAHFDNSGDGA
GLWASGSHMDQLIFPDHGTKYGRQSQGREGLDQAQSRASWASSTGYWGEDSEGDTGTIKR
RGGKDVSIEAETSSITSVPAEESKPAPMPTHIPASSSSTKGLIAARKEGRYREPPPTPPG
YVGIPIAEFAEGVSHPTRKPPDYNIALQRSRMVARTCETHGTSTQQQQSHGHSTSRPVNK
PQWHKPNESDPRLAHYQSQGFSAEEDEDEQVSAV
Download sequence
Identical sequences U3I068
ENSAPLP00000000638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]