SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000754 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000000754
Domain Number - Region: 124-187
Classification Level Classification E-value
Superfamily Spectrin repeat 0.027
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0408
Family RecQ helicase DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000754   Gene: ENSAPLG00000001230   Transcript: ENSAPLT00000001325
Sequence length 227
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742870.1:255548:257672:1 gene:ENSAPLG00000001230 transcript:ENSAPLT00000001325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPSVPQLADSEFSPVFRLLTIFAYGTYADYLAEAANLPPLTEAQKNKLRHLSVVTLAAKI
KCIPYSVLLEQLQLKNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIRREELS
TITRTLQEWCQGCEVVLSGIEEQVSRANQHKEQQLALKQQIESEVANLKKTIKVTTAAAA
AATSQDPEQHLTELREPAPGTNQRQASKKTSKAKGLRGSAKIWSKSN
Download sequence
Identical sequences U3I0I4
ENSAPLP00000000754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]