SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000834 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000000834
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00316
Family Linker histone H1/H5 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000834   Gene: ENSAPLG00000001416   Transcript: ENSAPLT00000001405
Sequence length 127
Comment pep:novel scaffold:BGI_duck_1.0:KB742823.1:352163:352543:-1 gene:ENSAPLG00000001416 transcript:ENSAPLT00000001405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIKLSIRRLLAAGVLKQTKGVGASGSYRLAKGDKAKKAPAAGRKKKKKAARRSTSPKKGA
RPRKARSPAKKPKAAARKARKKSRASPKKAKKPKTVKAKSLKAPKVKKAKRSKPRAKSGA
RKSPKKK
Download sequence
Identical sequences R0LE74
ENSAPLP00000000834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]