SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000967 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000000967
Domain Number - Region: 26-62
Classification Level Classification E-value
Superfamily ARID-like 0.0575
Family ARID domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000967   Gene: ENSAPLG00000001494   Transcript: ENSAPLT00000001538
Sequence length 101
Comment pep:novel scaffold:BGI_duck_1.0:KB743301.1:937622:939609:-1 gene:ENSAPLG00000001494 transcript:ENSAPLT00000001538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKVVLLGLYTVLAVRGLTKGAPFQPEEKWKPLDNPRNRDLFFRTLQAYFSGRGLDLRKF
PATFTMNNEGPRPVMFYSDPIASAFADYEERKNSFPNHFKG
Download sequence
Identical sequences R0JQF2
ENSAPLP00000000967 XP_005021929.1.99704 XP_005021931.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]