SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000970 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000970
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-25
Family Ras-binding domain, RBD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000970   Gene: ENSAPLG00000001547   Transcript: ENSAPLT00000001541
Sequence length 440
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742993.1:935695:937043:-1 gene:ENSAPLG00000001547 transcript:ENSAPLT00000001541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGLNRNKIKFYLNLRSPSKEMASNEREIVVWVCQEEKIVCGLTKRTTCAEVIQALLEEH
QATFGEKKVLFGKPSDYCIVEKWRGSERVLPPLTKILRLWKAWGEEQPNLHFVLVKSDAF
LSFPLWKTAEAKVVQNVEKQWELSPANYMKMLPIDKQKKIVRKTFRKLAKLKQDSVQQDR
DNMETLIHLIISQDHTIHQQVLRMKELDMEIEKCEAQFHLDRVANDGENYVQNSYLTINP
SEAEQQGSRPDDQKEMHEYFSKSEGILQVEERLKHHKQLIEKLCAEIEKEVYGICSEKKG
DDIHTEGASHAQLENSNLESVKYELEKSMKDGLRINSYLSCIQKELTYRDSLLQKKEKEY
ELLTEEFNLLHIKDNIETRLPLNEEPPKGSGNSSTSIAVPDFVHRVTNLDINDTDSDTGI
SSTHSQDSEITSGDMVLLST
Download sequence
Identical sequences U3I150
ENSAPLP00000000970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]