SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001085 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001085
Domain Number 1 Region: 573-661
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-21
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 386-479
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 278-329
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000693
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 4 Region: 537-572
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000034
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001085
Domain Number - Region: 32-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0925
Family Ubiquitin-related 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001085   Gene: ENSAPLG00000001367   Transcript: ENSAPLT00000001656
Sequence length 684
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742875.1:553406:571647:1 gene:ENSAPLG00000001367 transcript:ENSAPLT00000001656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYTDLWKMTSLGAYGSNSWELLVSVDHQNEEKQKEFTLQVTGDLHIGGVMLKLVEQIEMT
QDWSDYALWWEQKKCWLLKTHWTLDKCGVQADAKLLFTTQHKMLRLRLPNMKTVRLKVSF
SSVVFKAVSDICKILNIRRSEELSLLKQSEDAIRKKKKKDKNNKEPVTEDILNLCNSPVS
SGLSASPGLYSKTMTPTYDPVSGTPASSTITWFSDSPLTEQNCNILAFSHPICSPETLAE
MYQPRTLADKARLNAGWLDSSRSLMEQGILEDDQLLLRFKYYTFFDLNPKYDAVRINQIY
EQARWAILLEEVDCTEEEMLIFAALQYHISKLSSSSETQNFPGESEVDEIEAALSNLEVA
LEGGKTSNILEDITDIPKLADYLRLVRPRKLSIKSIKPYWFVFKDTSVSYFKNTESSHGE
PIEKLNLKGCEVVPDVNVAAKKFGIKLLIPVADGMNELYLRCENENQYARWMAACVLASK
GKTMADSSYRPEVHKILSFLKMKNWTMSPQAVSDPENVDMKPECFVSLRYTKKYKSKQLA
ARILEAHQNVSQMSLVEAKMRFIQAWQSLPEFGLSYYIVRFKGSKKDDVLGVSYNRLIRI
DIATGDPITTWRFSNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKSIHEYIGGYIFL
STRSKDHNETLDEELFHKLTGGQE
Download sequence
Identical sequences U3I1G5
ENSAPLP00000001085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]