SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001123 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000001123
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0209
Family Forkhead DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001123   Gene: ENSAPLG00000001701   Transcript: ENSAPLT00000001694
Sequence length 197
Comment pep:novel scaffold:BGI_duck_1.0:KB743464.1:604216:604806:1 gene:ENSAPLG00000001701 transcript:ENSAPLT00000001694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKGNYWTLDPNCEKMFDNGNFRRKRKRRSEPNTPASASAASSLGALKTEEERPIAAGGK
PCGTSPPPELDPSPSARDHPKSSSPSGIISSTPSCLSTFFSGMSSLSGGGGRLTGGLSSD
LHHRNFSAGQLSSGTFTPSSSSSQEVPSPEQLQRVAGPSPAYYSSFHPSSGSQGAQYNHY
YNFTVNSLIYTRDGTEV
Download sequence
Identical sequences R0JMJ7
ENSAPLP00000001123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]