SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001140 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001140
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily dUTPase-like 9.29e-19
Family dUTPase-like 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001140
Domain Number - Region: 116-162
Classification Level Classification E-value
Superfamily Acid proteases 0.000296
Family Retroviral protease (retropepsin) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001140   Gene: ENSAPLG00000001718   Transcript: ENSAPLT00000001711
Sequence length 162
Comment pep:novel scaffold:BGI_duck_1.0:KB752659.1:330:815:1 gene:ENSAPLG00000001718 transcript:ENSAPLT00000001711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATRGSLGLDLATAIDVTIIDQKPVKIPPTTMGPLIIDKKPHGALLIGCSSSRIKGLFIL
PGVIDADYKGTISIVVQTLFPPLHIPAKSKIAQLVPLPQLTEGTKATTDVSRGTQGFGST
GGLAMLTMAMNQWPVVSVTLYSAGEKLDLDMLLDTGADLTIV
Download sequence
Identical sequences U3I1M0
ENSAPLP00000001140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]