SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001310 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001310
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000149
Family BCR-homology GTPase activation domain (BH-domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001310   Gene: ENSAPLG00000001888   Transcript: ENSAPLT00000001881
Sequence length 53
Comment pep:novel scaffold:BGI_duck_1.0:KB815316.1:289:447:-1 gene:ENSAPLG00000001888 transcript:ENSAPLT00000001881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLHSQQNLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQNIVVEILIEHYEK
Download sequence
Identical sequences U3I240
ENSAPLP00000001310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]