SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001418 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001418
Domain Number 1 Region: 440-681
Classification Level Classification E-value
Superfamily Cullin homology domain 3.14e-67
Family Cullin homology domain 0.00069
Further Details:      
 
Domain Number 2 Region: 707-779
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-21
Family SCF ubiquitin ligase complex WHB domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001418   Gene: ENSAPLG00000001836   Transcript: ENSAPLT00000001991
Sequence length 783
Comment pep:novel scaffold:BGI_duck_1.0:KB744204.1:705935:716016:-1 gene:ENSAPLG00000001836 transcript:ENSAPLT00000001991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPRSDPVGPLKDADLRAALEVLRCYDLHSIVEEWFIEVLQTDLQANIAPEFWNCIGQYE
NTAEEPQCSSLLLDAFCLLKCRLDPYLNSLELLERWTKAGLLLGTGAQMLQEKVYTMFKA
ILFFSTTKSFQEMIQQFYSRTFRIYMRQWKKGEEGMNECESSMSENEQESDTEEGGGESQ
VCAGCGSKREQCWCPKAMEQFQQLNDILRRLNLLERVSADAVTTILHRMIEERMEQRCRG
EYEHSFLNEFQEWIEKVIGWLSRVFLQDGPLARSSPEASSTLKRWRCHVQRFFYRIYASM
RIEELFSIIRDFPESKPAVEDLKFCLERTNQRQQLLSSLKSALEMRLLHPGVNTSDIITL
YISAIKALRELDPSMVILEVACEPIRKYLRTREDTVRQIVAGLTGDAEGSGDLANELSKA
DPVTLENGQESDDDISEPGDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEY
RTLLADRLLHQFNYSAEREIRNVELLKLRFGEAQMHYCEVMLKDMADSRRINANIRDEEE
KLPEEERPPFSLVAVILSSEFWPPLKEEKLELPEQVKEAMEAYSKKYEKLKAMRTLNWKY
HLGLVNLDVELADRTLSLSVSPVHAAIILHFQTKSTWTLTELSEVLKVPVTSLKRKMTLW
LQQGVLREEPPGTFTVIEEEQKDQVEKVVLIDSDEEGDSAMASQADQKEEELQLFWTYIQ
AMLTNLESLSLERIHSMLKMFVMTGPVVTEIDTQELQGFLQKKVRDQQLIYSGGVYRLPK
NCN
Download sequence
Identical sequences R0JEK2
ENSAPLP00000001418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]