SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001441 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001441
Domain Number 1 Region: 485-773
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-51
Family Tandem AAA-ATPase domain 0.0003
Further Details:      
 
Domain Number 2 Region: 34-189
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.31e-39
Family DnaQ-like 3'-5' exonuclease 0.017
Further Details:      
 
Domain Number 3 Region: 851-973
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-26
Family RecQ helicase DNA-binding domain-like 0.0000307
Further Details:      
 
Domain Number 4 Region: 1054-1138
Classification Level Classification E-value
Superfamily HRDC-like 2.11e-17
Family HRDC domain from helicases 0.0000905
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001441
Domain Number - Region: 375-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000779
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001441   Gene: ENSAPLG00000001616   Transcript: ENSAPLT00000002014
Sequence length 1387
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743713.1:1469019:1508600:1 gene:ENSAPLG00000001616 transcript:ENSAPLT00000002014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSLLEDGLPFLEFCGSIVYSHSLLSEDIRQTLSCGAAVGFDIEWPPSYTKGKMAKIAVI
QLCVTEEKCYLFHVSSMSGFPKGLKRLLEDETIKKVGVGIEGDQWKLMSDFEIKLKSFVE
LADVANEKLKCKELWSLNGLVKHLFGKQLLKDKTVRCSNWEKFPLNEEQKLYAATDAYAG
FIIYQKLKNMNSNDRKLFGERRGNVSDDVKEHLGSLAEEMVYLASRIPDSSGQPGSLQRA
AEILADISENIKALRSTLLAASCSPSVLERSCGEAPTKLEVESASAEAQKVEMRELAKKL
EGDINMCSDDRADRNDFMSLDITEQELQMLEHQAAEEYLNNAMPEEECATDNKHNISCVI
ESDEELEMEMLKSLEDVDKPKEILTENESSRARKTPDDPELNVAPDGDEDEGIEEEEEEC
WDPLLPVPSEIQVTCLKTYFGHSSFKPVQWKVISSVLEDKRDNLVVMATGYGKSLCYQFP
PVYTGCTGIVICPLISLMEDQVLQLTMSGIPACLLGSAQSKNVRDGIKAGQYRVIYMTPE
FCSGNLDLLQDLDQTIGITLIAVDEAHCISEWGHDFRNSFRTLGSLKKTLPMVPIVALTA
TASPSIREDIVNCLNLKNPLVTCTSFDRPNLYLEVGRQSGNMIRDLKQFLTRKGSSSEYE
FEGPTIIYCPSKKTTEKVVSELTKLNVPCGAYHAGMGIQKRRETHHQFMRDEIQCVVATV
AFGMGINKADIRMVIHYGAPKEMESYYQEIGRAGRDGLPASCHVLWAAADLTFNRHLLTD
IRSEKFRLYKLKMLEKMEKYLTSNSCRRKIILSHFEDKQLRKVSSGIMGTDDCCDNCRCR
TSCLVTPSDSEGGLQDFGQQAYQLLSAVCALEEKFGIKVPILFLRGSSSQRLPERYRKHP
LYGSGKDWTESWWKSLCQQLIMEGFLKEVSGQNKYMTTCGLTQKGRNWLLKSGSTSNPSL
LLQSNEDLNLQRTPRRNFNFQKSCKSSPVASAQGSQSTKRTKQSPGKQMSLYEMFSYEKK
DGTSPRRNTVLNSFPEHSPVRSPLKSREPVSSPEKELQTALYGKLLTARQKVANEKAVPP
AVLATNKILVEMARIRPTTVENVKRIEGVSEAKSTMLVPLLAEIKDFCQANGLQTDAFPT
DQKEASHRKHARALSPSEHVTYVLFQDKNLSVRTISETRSLPLSEIGTHLLQAMKAGYPV
NLERAGLTPEVKKIISDVIHNPPIDSEDTTKIQAIRTLVPANIELYLIQMAIALLEKENG
NKAQRGSGAKRVLVWSDGQQEKRGADQASKEDALWSEKKKCPGQTTTGKKKTNTGAAGHT
KPIALASWNQPALNPEEEELFSDSQPKGSQPPCKRKVPAWFEAPTAPVVPVPQIKKPKAD
TRKGIFN
Download sequence
Identical sequences U3I2H1
ENSAPLP00000001441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]