SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001677 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001677
Domain Number 1 Region: 11-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000314
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001677
Domain Number - Region: 704-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00212
Family Extended AAA-ATPase domain 0.087
Further Details:      
 
Domain Number - Region: 1148-1184
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 0.0392
Family AmyC C-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001677   Gene: ENSAPLG00000002252   Transcript: ENSAPLT00000002251
Sequence length 1583
Comment pep:novel scaffold:BGI_duck_1.0:KB742513.1:519527:524278:-1 gene:ENSAPLG00000002252 transcript:ENSAPLT00000002251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKEKLHFYQHAETWTKEEVKQFLTEILKIDQKYAEILYDQDVTGSTLKLLTKADLVEMGI
PHGPAIQIIHFLKKHGILTESSNQAEGQEGSEQSIGGEDDEEIVKNECKKKYRSFNSSIL
QDSELEPVENKTAIKSADEENVSEKSPSSSQHPARNICMPHPFDNFSDGTRYIQHHILNV
PETGPLNLIDPAHEFKLLCNTENALEEDIKMKFSNEVFRFAAACMNSRTNGTIHFGIHDN
PHGEIKGIKVTKKEAYIDHFNRHIEKYFDKQYIGAAKACIREPRFVEVLLPNETPSDTFV
IEIDVVPRHSICNTKYFCTNIYDFKSKCFRKAVFIRNGASSKNIINTDEFEKFKCNLTLL
ADSRKRAEEEYNLKQKKTMNEGLKLISLLTGNRDMLDDCYYDYYILVTNKCHPSQTSHLD
FLQEIKWFAVLDFDPESEKNGVFKTYQKTRNAKLRFPYHYENKVGSVSEQAEKLNLHQET
NWIFCNGIIAESGSDFQSNKELPLDHASWQRDRAAEVRKMISFLSHKDVKQSGKFLIVFL
LLSRVEDPLDPLAETFVTFYQELKGLEDMACICIGAGTDQRWKDLLHARGIREEALSNKC
VSNLTLEMVNGTIIKAKSVTQSSKRLLPSIGGSTILLKKEEDFIAALEILCENECKDTEI
EKDEEQFKKFMKEREKDFYRGGRVTWWNFYFSSENYTSVFVKRDRYENLEQLIVSSANSA
NQSPVKIINLYHHPGCGGTTLAMHILWNLRKQFRCAVLKNKTSDFGTQVATLITYGANKD
SGYLPVLLLVDDFEEQENVYLLQNEIQAAITEKCIPYVNPLVIVLNCMRSQNPDENATIN
SLNSISLKQTLSEKEQRAFEQKLKDIEKMHPNPDNFYSFMIMKKNFDPKYIEKLVKNTLR
DLNINSKSAQLVYYLTLLNAYVRTSTLSISLCEEFLGINSREIGKKDKLIEKMGICSNIL
MYTRVQEHMTYRGLRIIHTLIAEWCLTEFKLTYNLPKSEITLRLLKEDLLYENSLQQDKL
TRDIITLLITRQRRERGYESDTWFSPLIEAIHKEEKYFNVERVLKEASTRFKKNSHICQA
LARYCYIKENEYDSALFWAKEAQDRAPHSSYISDTLGQVFKHRLRYQVEHRGKSAVLTAQ
ELDCLLDLAQSASWAFRTSQHQAKNAAIEQNFQHQKRKRKLQNYNTLGYQGEIETGLYII
DVLQHTPFFSKEDSQCRKRMIMYLSGNSALNLDSPSTESEVLKHYSSFLKNLRSQLKRAF
GFLEDYFVFFKTPTNEREFVEAKMAETVRECFKKYTKIFCDSSVEQLRSQQALGWSLSQK
IVAYRKAVEASKADSFSGVLAYLYKNQRNADREIEDIVYAYTFLCEANSQATLKEKQNFI
LANVVLNCIKPESTELCHFEGLRSQLVSILEKVELNSYCVEPFFLASLLFWPENIKQLNE
DSRKMDKYVRRLYESFKELYGAIGCFKQPVAHFYLAKGSGLNRFVHKRKIDQLFSSLSEQ
ELNDLWRNENIWKEKVVRDLLLPLNGRAEGTVIYINYGINEPFRIPVKPVPSFLLKKGPN
IQRVSFYLGFSIAGLLAYNVHSL
Download sequence
Identical sequences U3I357
ENSAPLP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]