SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001759 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001759
Domain Number 1 Region: 25-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-19
Family Linker histone H1/H5 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001759   Gene: ENSAPLG00000002330   Transcript: ENSAPLT00000002335
Sequence length 197
Comment pep:novel scaffold:BGI_duck_1.0:KB742585.1:126577:127167:1 gene:ENSAPLG00000002330 transcript:ENSAPLT00000002335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNTSGEAAKKPKKAAGGSKARKPAGPSVTELITKAVAASKERKGLSLAALKKALAAGGYD
VEKNNSRIKLGLKSLVGKGTLVQTKGIGASGSFRLSKKPGEVKEKAPKKRAAAAKPKKPA
AKKPASAAKKPKKAAVKKSPKKAKKPAAAATKKAAKSPKKATKAAKPKKAAAAKSPAKAK
AVKPKDPRLPSRKQPRQ
Download sequence
Identical sequences U3I3D9
ENSAPLP00000001759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]