SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001813 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001813
Domain Number 1 Region: 255-443,754-901
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-115
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000581
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DUSP-like 2.88e-30
Family DUSP, domain in ubiquitin-specific proteases 0.00000199
Further Details:      
 
Domain Number 3 Region: 116-187
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000103
Family UBX domain 0.085
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001813
Domain Number - Region: 469-568
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.000144
Family RNA 3'-terminal phosphate cyclase, RPTC 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001813   Gene: ENSAPLG00000001801   Transcript: ENSAPLT00000002389
Sequence length 951
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742520.1:318578:373358:-1 gene:ENSAPLG00000001801 transcript:ENSAPLT00000002389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDSQSLKEHLIDELDYI
LLPTEGWNRLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTR
RFSKADTIDTIEKEIRKIFNIPGEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV
IEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSLSNNYNNMNNRNVKNSNYCLPSYTAY
KNYDYSEPGRHNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNP
LGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDG
LHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPEC
AKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLAKPMQYKVVVPKIGNILDLCTALSV
LSGVAADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEIAINRTEDTEQVIIPVCL
REKCRHTSYSHSGSSLFGQPFLIAVPRNNTEDKLYNLLLLRMCRYVKTCTESEDTEGSLH
CCKDHGINGNGPNGIHEEGSPSEMETDEQDDESSQDQELPSENENSQSEDSVGGDNDSEN
GLCTEDTCKGQPLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQPRLDERSFLAL
DWDPELKKRYFDDRAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYCPN
CKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPNAG
PCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTACEDQIVSKAAYVLFYQ
RQDTISGTGFFPLDRETKQGASAATGIPLESDEDSNENDNDIENENCMHTN
Download sequence
Identical sequences U3I3J2
ENSAPLP00000001813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]