SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001824 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001824
Domain Number 1 Region: 216-316
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.66e-29
Family Ras-binding domain, RBD 0.0000025
Further Details:      
 
Domain Number 2 Region: 7-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.24e-24
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 376-471
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.92e-21
Family FHA domain 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001824   Gene: ENSAPLG00000002298   Transcript: ENSAPLT00000002401
Sequence length 1001
Comment pep:novel scaffold:BGI_duck_1.0:KB745911.1:13868:65499:-1 gene:ENSAPLG00000002298 transcript:ENSAPLT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYS
LYEVHVSGEERRLDVDEKPLVVQLNWNKDDREGRFVLKNENDTLPPKKAQSNGPEKQEKE
GVIQNFKRTLSKKEKKEKKRREKEALRQASDKDDRFLHGDDIENSRLAAEVYKDMPETSF
TRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTT
DTADFAVIEALEKYGLEKENPKDYCIARVMLPPGAQHSDDKGAKESILDDDECPLQIFRE
WPSDKGILVFQLKRRPPDYVPKKSKKTADGKPLKGKDRVDGSGYGSCLPPEKLPYLVELS
PGRRNHFAYYNYHAYEDGSDSRDKPKLYRLQLSVTAVGTEKFDENSIQLFGPGIQPHHCD
LTNMDGVVTVTPRNIDAETYVEGQRISETTMLQSGMKVQFGSSHVFKFVDPTQDHIIPKR
PIDASLMVKGPRHKTGAVQETTFDLEGDVHSGTALPVSKSTSRLDGDRTSSASSTAERGM
VKPMIRIEQQDYRRQDSRSQDTHGPELILPASIEFRESSEDAFLSAIINYTNSSTVHFKL
SPTYVLYMTCRYVLSSQYRPDITPTERTHKVIAIVNKMVNMMEGVIQEVDQVDQKQKNIA
GALAFWMANASELLNFIKQDRDLSRITVDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAF
LDDPEENNPQRPKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTA
PDSGLCSHYWGAIVRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHADVPN
INSTCFKLNSLQLQALLQNYHCAPDEPLIPTELIENVVTVAENTADELARSDGREVQLEE
DPDLQLPFLLPEDGYSCDVVRNVPSGLQEFLDPLCQRGFCRLIPHPRSPGTWTIYFEGAD
YESHLSHENAELAQPLRKEPEIITVTLKKQNGMGLSIVAAK
Download sequence
Identical sequences R0J8S5
ENSAPLP00000001824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]