SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001872 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001872
Domain Number 1 Region: 715-791,825-914
Classification Level Classification E-value
Superfamily RUN domain-like 2.22e-36
Family RUN domain 0.002
Further Details:      
 
Domain Number 2 Region: 1074-1247
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-27
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 922-1019
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.47e-18
Family Lipoxigenase N-terminal domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001872
Domain Number - Region: 600-674
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0752
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001872   Gene: ENSAPLG00000002386   Transcript: ENSAPLT00000002450
Sequence length 1254
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743645.1:45412:88322:1 gene:ENSAPLG00000002386 transcript:ENSAPLT00000002450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCQYIQASKTRDGASRFISSATEASGENFEQTPLRRTFKSKVLARYPENVEWNPFDQDA
VGMLCMPKGLAFKTQADSREPQFHSFIITREDGSRTFGFSLTFFEEVTSKQICSAMQTLY
HMHNAEYDILHTPPTNDKDSCSSTGDCNGTSVSKLQRFNSYDISRDTLYVSKCICLITPM
SFMKACKKVLEQLHQAVTSPQPPPLPLESYIYNILYEVPLPPAGRSLKFSGVYGPIICQR
PSTNELPLFDFPVKEVFELLGVENVVQLFTCALLEFQILLYSQHYQRLMTVAETITALMF
PFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIE
LPEDLPQFPNKLEFVQEISEILMAFGIPPEGNLHCSESASKMKSLRACDLVSDKRNGNIA
GSPLNSYELLKENETIARLQALVKRTGVSLEKLEVREETSSKKDLKIQCDEEEFKVYQLN
IQIREIFANRFTQMFADYEVFVIQPNQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLS
RFLETQMFASFIDNKIMCHDEDDKDPVLRVFDSRVDKIRLLNVRTPTLRTSMAKKFNFLT
ISEKSIELRLAKIDHTAVHPHLLDMKIGQGKYELGFFPKLQSDVLSTGPASNKWTKRNAP
AQWRRKDRQKQHTEHLRLDNDQREKYIQEARNLGSTIRQPKLSNLSPSVIAQTNWKFVEG
LLKECRNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQG
KSALWSHLLHYLENRQRRTTSGSFSTSGILLDSERRKSDTSPAMSPLRISLVQDMRHIQN
ISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYH
LLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETGVLQIPR
NILEMTFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMD
DGSLERILVGELLTSNTEVDERQCRTPPLQQSPSMIRRFVTISPNNKPKLNTGQIQEAIG
EAVNGIVKHFHKPEKERGSLTLLLCGESGLVSALEQVFQHGFKSPRLFKNVFIWDFLEKA
QTYYETLEQNEMVPEENWQTRARNFCRFITAINNTPRNIGKDGKFQMLVCLGARDHLLHH
WIALLADCPITAQMYEDIALIKDHTLVNSLIRVLQTLQEFNITLEASLVKGIDI
Download sequence
Identical sequences U3I3Q1
ENSAPLP00000001872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]