SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001876 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001876
Domain Number 1 Region: 154-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.46e-31
Family ets domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001876   Gene: ENSAPLG00000002423   Transcript: ENSAPLT00000002454
Sequence length 266
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745135.1:66158:86142:-1 gene:ENSAPLG00000002423 transcript:ENSAPLT00000002454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQACKMEGFPLIPPPSEDMVPYESDLYRQPHDYYQYLNSEGESHGDHYWEYHPHHMHSE
FETFGDNHFTELQSVQPPQLQQLYRHMEIEQMHVLDSAIPTTHIGLNHQVSYLPRMCLQY
SSPLQPSSDEEDIERQSPPLEVSDGETDGVDPGPGIMHSETGSKKKIRLYQFLLDLLRSG
DMKDSIWWVDKEKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKK
VKKKLTYQFSGEVMGRGVTDRKLYPH
Download sequence
Identical sequences U3I3Q5
ENSAPLP00000001876 XP_005030066.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]