SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001892 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001892
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-25
Family DEP domain 0.018
Further Details:      
 
Domain Number 2 Region: 223-298,589-684
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000137
Family BCR-homology GTPase activation domain (BH-domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001892   Gene: ENSAPLG00000002417   Transcript: ENSAPLT00000002470
Sequence length 812
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743348.1:102265:113211:-1 gene:ENSAPLG00000002417 transcript:ENSAPLT00000002470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAPNGEPRGAFEPSRQWNEITRYFRAGMPLRKHRQRFKKHGSCFTASEAVDWLHQVLRSN
SNFGPEVSRQQTVQLLRKFLKNHVIEDIKGRWGSEDLEDNGVLYRFPSTSPVKPLPSSRR
EKENLETFSRDKERLFKLPHLSRRTVKKHELLDSLENLEKTEPDITKENKEDELHRKEIS
QEYVQEIWRNIILIHLQTILGLPSLEEILQPTQIVPEYVIYNMTNTSKHGVVILQNKSED
LPHWVLSAMKCLAYWPRNNDMNQPTYSGFERDVFRTVADYFLNLPEPLLTFEYYELFVNI
LVMCGYIKIPDLCSRKHSVQDETCDPQPSKILHLNSFKSTECLLLSLLCKEPEKKKKEYE
VSRKWSAEESAVQKQCAKKLQQYKLRSEQGSVDNLIGGSCQNLSGFRNEKDSALKFRTRC
YSLERIGGTASSVRNKGESVVLRQTDVNTVLGIRSKNQSLPYEHKANSALAFGFDNTYQN
QTYGVKTASASTLQDKELLDENHRSKEICRSQSLLGSRNSKSCTSINIPVAEITVKPTSQ
LCGQRKPNAAVDIRTEVSDITVSKRLCKSTIELSEYSFTHSCMLTGTQNLLQPHLERIAV
EALQICCLLLPPPNRRKMQLLMRMISRISENVDMPRLHDAMGTRSLMIQTFSRCVLCCAE
EVDLDELLSTRLVSFLMDHQQEIFKVPTYLQVAVQDHIEYMRMAQGKYPREEICAILPTY
SYCKQITPQEFEEQKVSTSQAAVAELLENIIKDKNLSVKDKKKKLKQFQKEYPLIYQNRF
PTTESEAILFENKPTIKQPMLSLRKPKFRSLR
Download sequence
Identical sequences U3I3S1
ENSAPLP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]