SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001893 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000001893
Domain Number - Region: 7-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000257
Family GntR-like transcriptional regulators 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001893   Gene: ENSAPLG00000002450   Transcript: ENSAPLT00000002471
Sequence length 205
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743211.1:277483:315494:1 gene:ENSAPLG00000002450 transcript:ENSAPLT00000002471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKKKGLSVEEKRARMMEIFFETKDVFQLKDIEKIAPKEKGITSMSVKEILQSLVDDGMVD
TDRIGTSNYFWAFPSKALHARKRKLEELQSQQLAESSQKKEALQKSIEKSKIGREDTAER
AALTEELAALRKKKEQLKAEIDKYRECDPDVVEEMRQTNKIAKEAANRWTDNIFAIKSWA
KRKFGFEESRIDKSFGIPEDFDYID
Download sequence
Identical sequences U3I3S2
ENSAPLP00000001893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]