SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001901 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001901
Domain Number 1 Region: 5-315
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-58
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number 2 Region: 401-473
Classification Level Classification E-value
Superfamily RING/U-box 1.34e-23
Family U-box 0.0026
Further Details:      
 
Domain Number 3 Region: 329-399
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.71e-17
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001901   Gene: ENSAPLG00000002463   Transcript: ENSAPLT00000002479
Sequence length 476
Comment pep:novel scaffold:BGI_duck_1.0:KB744209.1:184625:203511:1 gene:ENSAPLG00000002463 transcript:ENSAPLT00000002479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLIHTLADHSDDVNCCAFSPSLLATCSLDKTVRIYSLSDFTELSYSPLKGHTYAVHCC
CFSPLGHLLASCSTDGTTMVWDTHDGQVLAVLGQPSGSPVRVCRFSPESTYLVSGAADGS
VVLWNVQSLKLYRSGSVKDGSLVACAFSPNGNCFVTGSSWGDITIWDDTMRCLYNEKAHD
LGVTCCDISSQPISDGEHGSRYFQMASCGQDNKVKIWLILFADSLGVELRYKCTLSGHSA
PVLACAFSYDGQMLVSGSVDKCVIIYETNTGNILHTLSQHTRYVTTCVFAPCTALLATGS
MDKTVNIWQFDSKQPCAGNTVEKESEVAVQNWSEDDVSAWLCAQGLTDLVGLFKRNNIDG
KELLHLTKESLTNELKIESLGLRSKILQKIEELRMKMVSVSVAIPDEFLCPITRELMKEP
VIAADGYSYEKEAMENWISNKRRSSPMTNLPLHSLMLTPNRTLKMAISRWLETQQK
Download sequence
Identical sequences R0JEG9
ENSAPLP00000001901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]