SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001918 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001918
Domain Number 1 Region: 415-549,576-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.04e-68
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 128-398
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-63
Family Ankyrin repeat 0.0000202
Further Details:      
 
Domain Number 3 Region: 724-867
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.52e-40
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 1029-1232
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.92e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0019
Further Details:      
 
Domain Number 5 Region: 974-1016
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000963
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001918   Gene: ENSAPLG00000002335   Transcript: ENSAPLT00000002497
Sequence length 1250
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744150.1:9753:111589:1 gene:ENSAPLG00000002335 transcript:ENSAPLT00000002497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LESPPGRPVAHHHRHLSPPHPPAGPGSGGPRHPSSPAERSGGGCPGTSPPAPARHRGRRG
FPPYTPQRGAPWNPASARNSPPRGRSAGGRRHSNSPPARTRLQVASSPAAESPEAASGAF
RELLDTGNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGASVHARDDGGLIPLHNACS
FGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSA
LDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAG
YNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTP
LHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAR
EADLAKVKKTLALEIINFKQPQSHETALHCAVAAVHPKRKQVTELLLRKGANVNEKNKDF
MTPLHVAAEKAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLNYGSDPS
IISLQGFTAAQMGNEAVQQILSESTPVRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCR
DLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVR
HGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQ
DLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLE
HGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQL
CALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLIS
PASTPSCLSAASSIDNLTGPLAELAVGGPSNAGDGAAGTERKEGEDVSPNDGSGNKYLKW
RGLPEGGSNKESSKITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYL
TFHCVSQGTILLDLAPDDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKK
LRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAEN
SSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHS
VIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIVKPEAPSQTATAAEQKT
Download sequence
Identical sequences U3I3U7
ENSAPLP00000001918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]