SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001924 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001924
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.76e-19
Family SAM (sterile alpha motif) domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001924
Domain Number - Region: 289-369
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0213
Family Type 2 phosphatidic acid phosphatase, PAP2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001924   Gene: ENSAPLG00000002477   Transcript: ENSAPLT00000002503
Sequence length 419
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742907.1:593195:608185:1 gene:ENSAPLG00000002477 transcript:ENSAPLT00000002503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQLSGEMKEVLLWSPEEVTNWLTENAVPEYCEPLKSFTGQDLINLTEEDFKKTPLSRVSS
DSGQRLLHMIETLKMAHHIEAHKNGHINGHIPVSMRNTTHENGFSSKMKLNGVPNGYKKE
MIKIPMPEPERSQYPMEWGKTFLAFIYALFCFIFTTVTISVVHERVPPKEVQPPLPDAFF
DRFDRVQWAFSICEINGMILVGLWFVQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT
LPVPGMHFKCSPKLFGDWESHLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVILTLTYL
FIKEYSPRRLWWYHWLCWTLSMVGMFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ
VLKEASQTNLLARVWWYKPFQYFEKNVQGIVPRSYHWPFPWPVLHRGRQVKYSRLVNDT
Download sequence
Identical sequences U3I3V3
ENSAPLP00000001924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]