SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001960 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001960
Domain Number 1 Region: 143-693,872-1065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.98e-256
Family Motor proteins 0.00000000241
Further Details:      
 
Domain Number 2 Region: 2070-2257
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000678
Further Details:      
 
Domain Number 3 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000269
Family Ras-binding domain, RBD 0.0076
Further Details:      
 
Domain Number 4 Region: 2004-2063
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 1113-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000149
Family Motor proteins 0.04
Further Details:      
 
Domain Number 6 Region: 1075-1117
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000956
Family Motor proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001960   Gene: ENSAPLG00000002464   Transcript: ENSAPLT00000002540
Sequence length 2537
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742899.1:921471:1071990:1 gene:ENSAPLG00000002464 transcript:ENSAPLT00000002540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNDVGGRRRFEDSEYTLHIYPGSIAEGTIYCPITARKTSTAAEVIDSLINKLQLEKTK
CYVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRISGEDYRFLLREKNLDGSIHYG
SLQSWLRVTEERRRMVERGFLPQPQQKDYDDLCSLPDLNEKTLLENLRNRFKQEKIYTYV
GSILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRRKNQCIVISG
ESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKF
IQVNYQETGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEERSAFHLKQPE
EYHYLNQMTKKPLRQSWDEYCYDSEPDCFSVEGEDLKHDFERLQLAMEMVGFLPKTRRQI
FSLLSAILHLGNIRYKKKTYRDDSIDICNPEILPIVSDLLEVKEEMLFEALVTRKTVTVG
EKLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDMEESTKTLSIGVLDIF
GFEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRAEGISWHNIDYIDNSGCINLI
SKKPTGLLHLLDEESNFPQATNQTLLDKFKRQHEGNSYIEFPAVMEPAFIIKHYAGKVKY
GVKDFREKNTDHMRPDIVALLRSSKNAFICGMIGIDPVAVFRWAVLRAFFRAMVAFREAG
KRYIEKKTASQGHDDAVPCAVLKSVDSFSFLHHPVHQRSLEILQRCKEEKYSITRKSPRT
PLSDLQGVNTINERTQRDAYAVGWNGRMGMRHSRLTSPSSFLDKDGIFVNTTNSKLLERA
HGILMRNKNFKAKPSLPKHLLDVKSLKHLTNLTLHDRITKSLLHLHKKKKPPSISAQFQA
SLNKLMETLGQAEPYFVKCIRSNAEKLPLRFSDSLVLRQLRYTGMLETVRIRQSGYSCKY
SFQDFVNHFHVLLPQGISPSKHNIHDFFRKIKLNPDNYQVGRTMVFVKERERQLLQDLLH
QEVLRRITLLQRWFRSMLCRRQFLSLRQAAVIIQRFWRSYQSRKQGEPSPDPLVLSKAAV
VLQTHWRGFVERRRFLQMQFAAHLIQSCWREHSKRRHDAATSIQAAWRGHCAKRLYRASR
SKIISLQAACRGYLARQRFRALKEQRLKEMQLENGLSISEEDGLEAEGALEIKGSDPSKW
EDGSFEERVRAVEEHKSLMENNRVNHVDPLDTSANLLYKRHERASSQSGMDTEEEVIVRE
RPKSLEDLNQKKVVRAKRESRRMRELEQAKFSLELLKVRSTGGLSPSEERRWSTELVSEA
LHSPQGTPESESSQGSLEMLSCEDTPSKLVSLVLDEQDVQSFSPETQDSVPSSPQPDVNS
NLPSCRRMLSDSELPDNHTAKEHVVCDPQNYLYKTHPRETFLSSNLPTFYIPPQDNMKVK
QSLVENNLRNKAAEREEKTVTFSEIRKDSEQDQGKALGREEGEKSSAKREEHSVIKRLEK
LNVEKEERQKQLQLQNEREMMEQIRQQKEILERQRKAFEQLEKQGRVEALQRAELSRTKD
TALKPSKKADSRPQSALILHPQGTTTAGTPTSSVDIKGLTVGNRGGSPAHGAAKDRPVSM
FMERREGQAGTALESRCSSRLAPDPRDVPGSPFSRTERLRQPRAPHQATEETRASSMFFT
PKDNPFGLQIKIISKVNAQNKEASHQCLPKGELTRKPFKMPGSGRGETVQRFTSGEGQTK
LHKTMSQGEIGKLAAAQKTLAPDGRSQRAKMRFWVKGKQGEKKTPREKLATQSELLELYA
EQEAPNREQLPPVELGPHHLTPPRSPELSGIYRREFKENKEPSPKVKRKRSVKISNVALE
PVQWQNDSLQIITSASDLKSMDEFLLKKMNELDNEDSKKDTLVDVVFKKALKEFRQNIFS
FYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDWSESPVKVWVNTFKVFLDEYMLE
YKPLDCTAVKVPKTERKKRRKKEADVVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRAS
VCKLCKYACHKKCCLKTTTKCSKKYDPELSSRQFGVELSRLTSEERAVPVLVEKLINYIE
MHGLYTEGIYRKSGSTNKIKELRQGLDTDIDNVNLDDYNIHVIASVFKQWLRDLPNPLMT
FELYEEFLRAMGLQERKETVRGVYSVIDQLSRTHLSTLERLIFHLVRIALQEETNRMSAN
ALAIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVIEQMNKYKARLKDINSLEFAENK
AKSRLSLIRRSMGKGRIRRGTYPSPTSPVAVRLPSVSDVPEETMSSEEAMEMDVTEQQQA
AMQQEERVLTEQIESLQKEKEELTFEMLTLEPRASDDETLESEASIGTADSSENLNFDSE
GAISDRSERSVALSSLRPTKAEGPSRLRRHPRTRPDAAEPHLPRKRFQMYSKSPFYRAGG
PGEPSPTSGPPDDRPQFTTRGTFNPEKGKQKLKSVKKNSPPKTKEPPEGGTGRKRNPEAD
RAAGQQLVLLGSNEFMV
Download sequence
Identical sequences U3I3Y9
ENSAPLP00000001960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]