SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001961 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001961
Domain Number 1 Region: 68-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-35
Family The central core domain of TFIIE beta 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001961   Gene: ENSAPLG00000002511   Transcript: ENSAPLT00000002541
Sequence length 292
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743713.1:1508840:1533525:1 gene:ENSAPLG00000002511 transcript:ENSAPLT00000002541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSLLRERELFKKRALSTPAGAARPAPSRAQQGTCSKSCQRVVVSSGLAGARQVADHSN
GSFNLKALSGGSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEILDETQHLDIGLKQKQWL
MSEALVNNPKIEVVDGKYAFKPKYNLKDKKALLRLLDKHDQRGLGGILLEDIEEGLPNAQ
KAIKALGDQIIFVNRPDKKKILFYNDKSCQFTVDEEFQKLWRSIPVDSMDEEKIEEYLKR
QGISSMQEAGPKKIAPIQRRKKPASQKKRRFKTHNDHLAGVLKDYSDVVPGK
Download sequence
Identical sequences U3I3Z0
ENSAPLP00000001961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]