SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002196 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002196
Domain Number 1 Region: 922-992
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.57e-19
Family SAM (sterile alpha motif) domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002196   Gene: ENSAPLG00000002713   Transcript: ENSAPLT00000002782
Sequence length 993
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742597.1:429994:442903:1 gene:ENSAPLG00000002713 transcript:ENSAPLT00000002782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METESEQNSGSSSGSSSSGGSTRPQISQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQ
QLNSAQLHSLAAVQQATIAASRQASSPNTSTPQQTTTTQASINLATTSAAQLISRSQSVS
SPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNG
AVAAVQQEVPPTQSPGVHADTDQVQNLAVRSQQTSSTNAQLQSSAQKAALPGNSQASCLP
QATSTGQTLAAAQVSSSSTGQSLNLSQGAAGSNGVSGGVVASSGSQTSTGLSQTASAGAA
GSCQRKGTGVVQPLPVAAAQAVTISQGSQTDTENAATKKGETDSGGQQTVGMNLTRTATP
APSQTLISSATYTQIQPHSLIQQQQQIHLQKQVVIQQQIAIHHQQQFQHRQSQLLHTATH
LQLSQQQQQQQSPSLTQQQQQAQPPQQQAPPQNQQQAQTLVVQPMLQSQAQPVQLQQDSS
CQPATKSPVPIQSKSMVAPIKPPQLGPAKMSAAQQPPPHIPVQVVGTRQQGSGQAQALGL
AQITAAVTTSRGMPAVVQPVSQGHAASPSSSAPPSSQEAPPLTTGVNLAQVQGTTHMVKS
PASSPVVAQMPAAFYMQSVQLPGKSQTLAVKRKAESEEEKEESASVTALLPARSSPVTDS
PKNMEEKNGFGDKSDPAAAATPNTTSSEGASVTPTSAPTPNLAMVSRQMGDSKPPQAIVK
PQILTHIIEGFVIQEGAEPFPVGSQLLKESEKPLQGGAPSGQSENLSSNSPGGDSASMEL
DKKANLLKCEYCGKYAPATQFRGSKRFCSMTCAKRYNVSCSHQFRLQRKKMKEFQEANYA
RVRRRGSRRSSSEIARTKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRASHGER
DLANSSMAPPTPDLHGINPVFLSSNPSRWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQA
LLLLKEEHLMSAMNIKLGPALKICAKINVLKET
Download sequence
Identical sequences U3I4M5
XP_005012481.1.99704 ENSAPLP00000002196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]