SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002269 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002269
Domain Number 1 Region: 621-920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-83
Family Protein kinases, catalytic subunit 0.00000000074
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-74
Family Ephrin receptor ligand binding domain 0.000000833
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 3.46e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 915-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000002269
Domain Number - Region: 260-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002269   Gene: ENSAPLG00000002816   Transcript: ENSAPLT00000002856
Sequence length 993
Comment pep:novel scaffold:BGI_duck_1.0:KB742594.1:2145933:2296204:-1 gene:ENSAPLG00000002816 transcript:ENSAPLT00000002856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRSRLPSWIILCSVWLFRFAHTGEAQAAKEVILLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMESNQNNWLRTNWIAKSNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENQYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPKMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCDCEDSYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLVDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATA
TAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGT
KTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIK
TLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEYMENGALDAFLRK
HDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVVED
DPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDV
IKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERGERPKFEQIVGILDKMIRNPNSLKTPLG
TCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMS
LGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences R0M1N5
XP_005012424.1.99704 XP_013035648.1.65836 ENSAPLP00000002269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]