SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002273 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002273
Domain Number 1 Region: 286-368
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-20
Family PCI domain (PINT motif) 0.017
Further Details:      
 
Domain Number 2 Region: 81-303
Classification Level Classification E-value
Superfamily TPR-like 0.00000182
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002273   Gene: ENSAPLG00000002804   Transcript: ENSAPLT00000002860
Sequence length 393
Comment pep:novel scaffold:BGI_duck_1.0:KB743284.1:62046:79627:-1 gene:ENSAPLG00000002804 transcript:ENSAPLT00000002860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVKRDVQENDEEAVQVKEQSILELGSLLAKTGQAEELGGLLKYVRPFLNSISKAKAARLV
RSLLDLFLDMEAATGQEVDLCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQL
GSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAA
LDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDNPKAITALKYMLLCKIMLNIPEDVQA
LVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYKVELRDDPIINTHLAKLYDN
LLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFD
EPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT
Download sequence
Identical sequences R0LDU3
ENSAPLP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]