SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002295 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002295
Domain Number 1 Region: 460-699
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-43
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 170-314
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-42
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 3 Region: 827-976
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 70-172
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-28
Family Second domain of FERM 0.0000953
Further Details:      
 
Domain Number 5 Region: 685-808
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-27
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 6 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-18
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002295   Gene: ENSAPLG00000002795   Transcript: ENSAPLT00000002882
Sequence length 993
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743179.1:24680:93914:1 gene:ENSAPLG00000002795 transcript:ENSAPLT00000002882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLQQRAPGKVLHDAVCNHLNLVEGDYFGLEFPDHKKMMVWLDLLKPVMKQIRRPKHVVV
KFVVKFFPPDHAQLQEELTRYLFALQVKQDLAQGRLTCNDTSTALLISHIVQSEIGDFDE
NIDREHLAKNKYIPQQEALEDKIMEFHRNHMGQTPAESDFQLLEIARRLEMYGIRLHPAK
DREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSFQDTLE
FLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKE
GGHKKVQFERKHSKIRSIRSLTTQPSEQHTEVPKQAPQSSSFAYGDDNDAAAVQSCRQGK
ELKASTEDNGQHKSPSLKKSPKEGRKVDGAVVSAVEEEEEASKDRIQQNRPQSQQPSTAG
SLTGSPHLSELSINSQGGPSVVNMSLSPNLSPDAKQSSPLISPLLNDPSCIRTEEEEEVR
RKRFPTEKAYFIAKEVATTERTYLKDLEVITSWFQSAVSKEDCMPETLKNLIFSNFEPLH
KFHTGFLKEIEQRLALWEGRSNAHIKGDYQRIGDVMLKNIQSMKQLTIHLWKHNEILMEL
ENGIKNSRKLETFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQIMERLCKHYPPAHVDFR
DSRAALAEISEMVAQLHGNMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLSKLSG
KGLQQRMFFLFNDILLYTSRGLTASNQFKVHGHLPLYGMTIEESEEEWGVPHCLTLRGQQ
QSIIVAASTRSEMDKWTEDIQMAIDLAEKSSGPAPELLASSPPDNKSPDETTVDQESEDD
LSASRTSLERQSPHRGNTTVHVCWHRNTSVSMIDFSIAVENQLSGNLLRKFKNSNGWQKL
WVVFTNFCMFFYKSHQDNHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAE
SEYTFERWMEVIRSATSSASRTRALSHKEPHAY
Download sequence
Identical sequences U3I4X4
ENSAPLP00000002295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]