SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002321 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002321
Domain Number 1 Region: 613-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.71e-81
Family Protein kinases, catalytic subunit 0.0000000129
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-61
Family Ephrin receptor ligand binding domain 0.000012
Further Details:      
 
Domain Number 3 Region: 330-533
Classification Level Classification E-value
Superfamily Fibronectin type III 1.81e-30
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 903-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.82e-20
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Domain Number 5 Region: 259-324,368-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000673
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002321   Gene: ENSAPLG00000002800   Transcript: ENSAPLT00000002909
Sequence length 971
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742847.1:40560:74502:1 gene:ENSAPLG00000002800 transcript:ENSAPLT00000002909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRTSTGRIELSLGLLLFWALLPSEVPGKEVDLLDTSTAQGELGWLPDPPEVGWSEVQQ
MINGTPVYMYQDCSVLSEGDTDHWLRTNWIYRGEAASRIYVELKFTVRDCKSFKGEVVTC
KETFNLYYMESEQDVGIQFRRPLFIKLNTVAADRSFTNRDIESGAMQLNTEVCPIGKLSR
RGFYLAFQNSGACVAMVSVRVYYKTCPEAVRGLARFPETLAGSEGLTEVLGACVEHAAEE
TGSPPRMHCSTDGEWLVPMGRCLCAVGFEEVDGSCVACQRGFYRHSLETNRCLKCPPNSL
SNESGATSCSCNTGFYRAPLEGQNIACTRPPSAPRNVSFSLIGTQLSLWWQPPSDHGGRK
DLTYTVFCQRCHFTSCEPCEAGVVFTPSASGLTKPAVDVDGLEAYTNYTFAVEAHNGVSG
MGPAPQRTAPAVWVAVGHAAPVTVSHFILTQRDDSSLSVSWLAPRQRSQTAVEYEVMFFE
KGEEARYTVKHLLEPNVTLTDLQPDTAYLLRVRSITPLGPGPYSQEQEFRTLPPDTGALS
GGVIVSIIFGVLLFIGLLLGLLFFRRKHARLRQSRPDYNTSGFDREKVWLKPYVDLQPYD
DPSRGVLEFIKELDVSCVTMENVIGEGEFGEVYRGSLRLPGKERIVVAIKTLKSTYSDSQ
WWNFLREATIMGQFDHPNIVHLEGVVTKRRPMMIITEYMENGALDTFLRENEEKFSPLQL
VSMLQGIASGMTYLSEHNYVHRDLAARNILVTRSLQCKVSDFGLSRILENDAEGTYETKG
GKIPIRWTAPEAIAHRIFTSASDVWSFGIVMWEVLSFGDKPYGDMTNQKVMKSLEDGYRL
PPPVDCPSILYELMKNCWSHDRMRRPQFHEIQAQLQHFISSPHLLRSVADFDPRVTLRLP
SCSGSDGIPYRSIPEWLESIRMKRYISNFRTAGLDTMESILDLTAEDLKQMGVSLPGHQK
RILCSIQGFKE
Download sequence
Identical sequences U3I500
XP_005016481.1.99704 ENSAPLP00000002321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]