SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002335 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002335
Domain Number 1 Region: 135-217
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.49e-20
Family Ankyrin repeat 0.00075
Further Details:      
 
Domain Number 2 Region: 21-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000191
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002335   Gene: ENSAPLG00000002896   Transcript: ENSAPLT00000002923
Sequence length 224
Comment pep:novel scaffold:BGI_duck_1.0:KB742479.1:1964955:1968427:1 gene:ENSAPLG00000002896 transcript:ENSAPLT00000002923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMSSLPPRTFGVRLCLAETNEMFSLPQCQNDLTLKKLKSHLELLTGIPLHFQRLQYLDE
MDLLDDSTFKDNDIIRGGTITMRIWRQDGWGHLVAAAAKGDTVKLAHLGVTEDFAGTTPY
AEILGPEQKKEWVAHRAFVALFVASHRGHVRTATFLLRHGADVHYKTPLGRTALHVAAVM
GRCDCIELLLSCGARALDPDSEGQTAVSLARLWGQQQSERTMIR
Download sequence
Identical sequences R0LQK7
ENSAPLP00000002335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]