SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002340 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002340
Domain Number 1 Region: 44-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-19
Family P4 origin-binding domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002340   Gene: ENSAPLG00000002900   Transcript: ENSAPLT00000002928
Sequence length 137
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744049.1:203016:204661:-1 gene:ENSAPLG00000002900 transcript:ENSAPLT00000002928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDVQKFSDNDKLYLYLQLPSGPSLGEKSSLDLSSLSTAEYMHACNWIRNHLEEHTDTCLP
KQDVYDAYKQYCDNLCXXXXXXXANFGKIIREIFPNIKARRLGGRGQSKTYCYSGIRRKT
VVSLPPLPSLDLKVTET
Download sequence
Identical sequences U3I519
ENSAPLP00000002340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]