SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002344 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002344
Domain Number 1 Region: 1243-1426
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000719
Further Details:      
 
Domain Number 2 Region: 29-44,129-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000001
Family G proteins 0.0087
Further Details:      
 
Domain Number 3 Region: 427-490
Classification Level Classification E-value
Superfamily FF domain 0.00000455
Family FF domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002344   Gene: ENSAPLG00000002888   Transcript: ENSAPLT00000002932
Sequence length 1503
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB746761.1:11453:22976:-1 gene:ENSAPLG00000002888 transcript:ENSAPLT00000002932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVVRSLEDCAECKMHVVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLCIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNIDLAF
NTLVQLVDKSRGKTKIIPYFEALKQQSQQIAAAKDKYEWLVSRIVKNHNETWSNVSRKMQ
SSAEYQEYVYLEGTQKAKKLFLQHVHRLKQEHIERRRKIYLAKLPQAFDALVPDLDEIDH
LSCVKVQKLLEAKPDFLKWFVVLEETPWDATSHIDNMENERIPFDLIETQPAEQLYEAHL
EKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYMWLEESIYMDIYSKH
QKQIIEKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQEVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPDCIDSKIEQLVSSCFIRPSERNQKNLLSDANIDRINL
VILGKDGLARELANEIRALCTNDDKYVIEGKMYELSLRPIEGNVRLPVNAFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTIGRRENHLAHLPLTLMLVNKRGDTSGETLHSLVQQ
GQQIASKLQCVFLDPASAGIAYGRNINEKQISQVLKGLLDSKRNLNLVSSTSSIKELADV
DLRIVMCLMCGDPFDADDLLAPILQSQSYRPSPCGSSSSILLELAVGPHRRRLELSLLSY
HSSFSVRKSRLVHGYIVFYAAKRKASLAMLRAFLCEVQDIIPVQLVALTDGAVDILDNEL
SREQLSEGEEIAQEIDGKFTAIPCSQPQHKLEIFHSFFKDVVEKKNIIEATHMYDNVAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPPTYSPFREDTAVPALPKDHSKLSMELEGN
DGLSFISVMSTFESKLNNKVPPPVKPKPPVHFDITKGDLSYLEQGHRDGQRKSVSSSSWL
PTAGYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDTSS
LERGRKVSAVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQSSQGYKGDN
AVIPYESADGEDPRRRNILRSLRRTTKKPKPKPRPSITKAMWESNYFGVPLSSVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIELVEAHKINDREQKLHALKEVLRKFPKENYEVFKYVIGHLN
KVSHNHRVNLMTSENLSICCTMDALTATRTYQTIIELFIQQCPFFFYNTAPVVQHPSNMV
QHPSNVVRHSPGFIRRGPTLVPCSPAQPEAPPPHPRLLQRGQNQLKAHPVRPKTRPTWPK
TPR
Download sequence
Identical sequences U3I523
ENSAPLP00000002344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]