SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002368 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002368
Domain Number 1 Region: 251-324
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-27
Family CPH domain 0.0000975
Further Details:      
 
Domain Number 2 Region: 926-1058
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.37e-22
Family APC10-like 0.017
Further Details:      
 
Domain Number 3 Region: 1145-1295
Classification Level Classification E-value
Superfamily Cullin homology domain 2.09e-17
Family Cullin homology domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1665-1717
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000489
Family RING finger domain, C3HC4 0.0035
Further Details:      
 
Domain Number 5 Region: 1504-1589
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000127
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 6 Region: 832-910
Classification Level Classification E-value
Superfamily ARM repeat 0.0000255
Family PBS lyase HEAT-like repeat 0.048
Further Details:      
 
Domain Number 7 Region: 1577-1645
Classification Level Classification E-value
Superfamily RING/U-box 0.0000653
Family IBR domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000002368
Domain Number - Region: 1308-1392
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000154
Family SCF ubiquitin ligase complex WHB domain 0.043
Further Details:      
 
Domain Number - Region: 41-94
Classification Level Classification E-value
Superfamily ARM repeat 0.0159
Family Regulatory subunit H of the V-type ATPase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002368   Gene: ENSAPLG00000002892   Transcript: ENSAPLT00000002957
Sequence length 1959
Comment pep:novel scaffold:BGI_duck_1.0:KB743318.1:233229:255187:-1 gene:ENSAPLG00000002892 transcript:ENSAPLT00000002957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPDEASLREMEADVGSLVRRAGRQLGGSGAASVLDTVHVLSAYAALVGAFRETGALDLL
ARMLCHKDKRICRSAGKMLRALASHDAGSRSYILLSLSQQDGVEQHMDFDSRYTLLELFA
EMMSSEEHCMSFEGIHLPQIPGKQLFALVKRYLRVTSLLEEQGGEQPESSRLKQEFEFSM
AMAGLIVELLRAMGWEHSHEPEPTARQETKPQTPRSIFQPKTPACFAAPAPVLSPNRGAQ
KKRGAAFLTLSDFTDRKSYVEYVQANLVPGMRVRLLEDCGEVRAGDEGEFMHSTDRMHTA
QVLWQSTGRTYWMHWHMLEIIGFGDQWDDPAGQEKEYSLIESFNLGKGEVLRVRLHHLFA
SAVAYFSVVNFISLGVFFFSRLDLAAKQTAKMRMWNLQGEAALGTHRFTINMPTICLTSC
HSTLEKVWKHCFRKKWHPLIFALAVGEDKREKSRLQVPLLCSASDVTLAGELDEASGLDL
TSARNEICMRSEANYPLSKCSHSQLKRRLLYRLLALVTKDLTACQFKLAKSMSSMSLRCK
NLRSRHIPTEVELKKLSAVGLDARPFGASLSLFCLHLQAVAWQIAASVDPAFLNRAVKVW
PNNGSYVPDLVLVALGVLALFETKVHWEAGGSGDLLGSSVWQRGARSRGAAGGADAASPR
PAATCAAPASTASTGRAGGPSGTAGAAPRCPRRVPAAGALGLVPRGTRQRGTRTTSVRSP
SRIPSCSESCWRGKGCASRRRRRAEVTPRGARARGAGTRXRASPRPQERRCFRALLRSLE
LRGAEKSIGLRILRWGWGAAGTLQDVAPAGGGAGAGQRGCLCVPRPEGPCPSLRILNKFL
DGFQEDALPWHECVEPCLSLLSAHSSDREVRGQGLCCLHRLAAASKDCAVAMCRAGTYEA
LAKALEKHSSAVPTAPALLQLLSXGLHRTLTGSILAGCIQLALGQIEEHRRSQRPISIPF
FDVFLRKLCRGSSVEAKEDKCWEKVQVSSNPHRAGKLTDGNPKTYWESNGSTGSHFITLH
MQCGVVVRELSMLVASEDSSYMPARVVVLGGDSPAAIRTELNAVSATGXQQAAFLGALGQ
GFAGALLQLPFLTALHVSPGGVAPQRPGVGPQPSALSLGEPPGAVGCPAHPARAPRTPVP
VPLQASERFARYLDGKIQELGGAAGSTGLLQQLLEPFVVFSGLEFAHTFEHFYRLYLGDR
LLAQGPSWLEGAVLEQLGLCFPRRFPQQMLSDLAESEELQRQFRLFQLQERDKRLLEPGA
ESPEHEAPGEAPEVTVLALSPRCWPVSPLCRMAEPRQRYLRAERAESGALERKRNVLCCL
LSRILKAEKRLHIDNLVFRVLAACQKGELGPGLQFPSFCCHSVDVLSCVLHLLNQGYLRR
QEERPQVLEYVPDEPTTPPGGQAQMVFQRSNSGTDRAEEFLLAMLPVPMGHTLSLEEAKL
LMNQTVQRVQDTLSIPEDVARHLLMHCRWNVDFLIHCYVEDRRSLLIASGLEVEDAQRPP
SPGTHCPVCVNQLCPTEKPPSLCCMHYCCKPCWNEYLTTRIEQNMVLSCTCPISECRAQP
TTAFIYSIVSSKEIIAKYEKALLRGYVECCSNLTWCTNPQGCDQILLKDGLGYEAACSKC
SWISCFNCNFPEAHYPASCSHMSQWVDDDGYYEGMTSEAQSKHLAKLISKHCPSCQAQIE
KNEGCLHMTCAKCNHGFCWRCLKPWRPTHKDYYNCSAMVSKAAWQEKRFQDYNERCTFHH
RAREFATSLRNRVSSVSEMPKIRTLTFVLHACKVLEQARKVLAYSCVYSYYNQDTESVDI
VEQQTESLELHTNALQILLEESLLQYQDLSSSLQLLKAEHFNTGLELVHRIKERLFAILW
HSTQDFRVGLETSTDPTWEWEGLRSDALLFNRPRPTIFCESPNTDEDGKENEDEEYDPQW
QEDYDDDDDDDLDEDNFQFDDESDNLDCDSYFDDDDAYD
Download sequence
Identical sequences U3I547
ENSAPLP00000002368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]