SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002373 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002373
Domain Number 1 Region: 195-335
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-39
Family Second domain of FERM 0.000000688
Further Details:      
 
Domain Number 3 Region: 493-580
Classification Level Classification E-value
Superfamily Moesin tail domain 2.88e-33
Family Moesin tail domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-25
Family First domain of FERM 0.00000897
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000002373
Domain Number - Region: 431-474
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0275
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002373   Gene: ENSAPLG00000002864   Transcript: ENSAPLT00000002962
Sequence length 580
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742725.1:123479:143127:-1 gene:ENSAPLG00000002864 transcript:ENSAPLT00000002962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKK
VTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVL
LASYAVQSKYGDYNKEIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLR
EDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMKAQKA
ELEEQTRRALELDQERKRAKEEAERLEKERRAAEEAKAALAKQAADQMKNQEQLAAELAE
FTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKSVMSAPPPPPPPPVIPPTE
NEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETK
KTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences U3I552
ENSAPLP00000002373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]