SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002429 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002429
Domain Number 1 Region: 531-647
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-29
Family UBX domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 332-487
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000313
Family Glutathione peroxidase-like 0.085
Further Details:      
 
Domain Number 3 Region: 89-171
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000216
Family Ubiquitin-related 0.018
Further Details:      
 
Domain Number 4 Region: 185-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000138
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002429   Gene: ENSAPLG00000002930   Transcript: ENSAPLT00000003018
Sequence length 649
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744148.1:482699:624828:-1 gene:ENSAPLG00000002930 transcript:ENSAPLT00000003018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMLLIQFTVSFSFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETL
QGPAYGPTSHSAAGSSTPSSSSAFRHVVPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSS
TVGDIKRILENELQIPASKMLLKGWKTGDVDDSTVLKTLHLPKNNSLYVLTPDLPLPSSS
HSGALQESLNQNFMLLVTHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWP
PSATDDSMTLAVSGLTFPCHRLTVGRRSSPVQTREQSEEQCTDVHMVSDSDGDDFEDATE
FGVDDGEMFGVASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVYFIGSLEAAF
QEAFYGKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDMTKEANR
ARFLTMCTRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLM
AAMEIFSAQQQEDIKDEDEREARENVKREQDEAYRISLEADRAKREAQEREMAEQFRLEQ
IRKEQEEEREAIRLSLEQSLPPEPKEESTESVSKLRIRTPSGEFFERRFLASSKLQVVFD
FVASKGYPWEEYKLLGTFPRRDVTQLDPNKSLLEVKLYPQETLFLEAKE
Download sequence
Identical sequences U3I5A8
ENSAPLP00000002429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]