SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002680 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002680
Domain Number 1 Region: 675-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-82
Family Protein kinases, catalytic subunit 0.00000000127
Further Details:      
 
Domain Number 2 Region: 62-233
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-71
Family Ephrin receptor ligand binding domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 358-562
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-44
Family Fibronectin type III 0.00001
Further Details:      
 
Domain Number 4 Region: 971-1042
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-21
Family SAM (sterile alpha motif) domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000002680
Domain Number - Region: 289-355,390-417
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000292
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002680   Gene: ENSAPLG00000003107   Transcript: ENSAPLT00000003273
Sequence length 1045
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742757.1:846035:877754:-1 gene:ENSAPLG00000003107 transcript:ENSAPLT00000003273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGSVPEPQGLLAPTQRRAEEPGEHPSTAVCSPACAGSWHCLEIPFCGLQPRARALSPSP
RVNLLDTSTIPGDWGWLTYPSHGWDSINEMDEFFSPIHTYQVCNVMTPNQNNWLRTNWVQ
RDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGTSTRESQFLKIDTIAA
DESFTNVDLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACIAIVSVRVYYKKCPAMVRN
LASFSEAVTGADSSSLVEVRGECVGHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEEQR
DACMACQLGFYKSAPGDQLCAKCPLHSHSESRAARVCRCDSSFYRAVQDPPSAACTRPPS
APVNLVSSVNGTSVTLEWGPPLDKGGRSDITYNVLCRRCGGDVGQCEACGSGTRFVPQQM
SLAQGALTVTNLLAHTNYSFWVEAVNGVSDLSLEARRAAVANITTNQAAPSQVVAVRHES
AGQNSVTLLWQEPDQPNGIILEYEIKYYEKDKEMQSYSTLKSKGTSATISGLKPATRYIF
QVRARTSAGCGRFSQTVEVETGKPVSLRYDTMTIVWICLTLITGLVALLVVLICKKRCPC
SLSPGGTGGMEEPGHSFPLLIFGQSTHRHCGYSKAFQDSDEEKMHYQNGQVKFPESKFYV
DPHTYEDPCQAVHEFTREIEASRIKIEKVIGSGESGEVCYGRLKLPGKREISVAIKALKA
GYTEKQRRDFLSEASIMAQFDHPNIIHLEGVVTRSKLVMIVTEYMENGSLDAFLRKHDGQ
FTIIQLVGMLRGIGAGMRYLSDLGYVHRDLAARNILVNSNLVCKVSDFGLSRILEDDPDA
AYTTTGGKIPIRWTAPEAIAYRKFSSASDVWSYGIVMWEVLAYGERPYWNMTNRDVINSV
EEGYRLPAPMGCPTALHQLMLDCWQKERSERPRFSQIVGVLDKLIRNPDSLKCTATVNRF
TQTPFDRGLLDFSGCLTVEDWLDSIRLGHYRDNFAMAGYSSLGMVMRMNIEDIRSLGITM
MGHQKKILSSIQAMRSQLLNTNGPR
Download sequence
Identical sequences U3I609
ENSAPLP00000002680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]