SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002707 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002707
Domain Number 1 Region: 117-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-17
Family Ubiquitin-related 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002707   Gene: ENSAPLG00000003246   Transcript: ENSAPLT00000003300
Sequence length 211
Comment pep:novel scaffold:BGI_duck_1.0:KB742452.1:1096657:1120363:1 gene:ENSAPLG00000003246 transcript:ENSAPLT00000003300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFES
NDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKGDLETLDIPD
PPPNSGHECQLRLRLSTGKDLKLMVRSMDTVYHMKRRLHAVEGVEPGSQRWFFSGRPLAD
KMKLEELKIPKDYVVQVIVSQPLANPTPVEN
Download sequence
Identical sequences R0LRK1
ENSAPLP00000002707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]