SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002833 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002833
Domain Number 1 Region: 2-163,191-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-64
Family FCH domain 0.002
Further Details:      
 
Domain Number 2 Region: 478-672
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000654
Further Details:      
 
Domain Number 3 Region: 725-783
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002833   Gene: ENSAPLG00000003289   Transcript: ENSAPLT00000003426
Sequence length 952
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742579.1:822431:872952:-1 gene:ENSAPLG00000003289 transcript:ENSAPLT00000003426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSR
EHQFKKDQHLLSPVNCWYLVLTQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKS
KEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDISVNL
LRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAVSKYYIHDV
SDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLDIIENAVDNLDARSDKHTIMDMC
NQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYHQLQSRLATLKIENEEVRKTLDA
TMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYMSKINIAKRRANQQETEMFYFTK
FKEYLNGSNLITKLQAKHDLLKQTLGEGERAECGTTRPPCLPPKPQKMRRPRPLSVYNHK
LFNGNMETFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERGED
PLADDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKTENPTERVHQIQQIIIT
LPRAVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHVNEV
IKTIIINHEGIFPSHRELEGPVYEKCMTGGEEYCDSPHSEPGTIDEVDHDNGTEPHTSDD
EVEQIEAIAKFDYIGRSPRELSFKKGASLLLYHRASEDWWEGRHNGVDGLIPHQYIVVQD
MDDAFSDSLSQKADSEASSGPLLDDKASSKNDIQSPTDHIVDYGFGGVMGRVRLRSDGAA
IPRRRSGGDTHSPPRGMGPGIDTPPRAAACPSSPHKIPLNRGRIESPEKRRMATFGSAGS
INFPDRKALSDGHPLRSTCGSTRHSSLGDQKSLEAEALAEDIEKTHCTAVHE
Download sequence
Identical sequences U3I6G2
ENSAPLP00000002833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]